PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_183770_oiew.t1
Common NameS1FA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family S1Fa-like
Protein Properties Length: 70aa    MW: 7700.39 Da    PI: 10.9143
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_183770_oiew.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA146.64.4e-46270270
               S1FA  2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                       av++veakGlnPGlivllv+gglll+flvgn+ily+yaqknlPP+kkkP+skkk+kre+lkqGva+PGe
  Sp_183770_oiew.t1  2 AVNEVEAKGLNPGLIVLLVIGGLLLTFLVGNFILYTYAQKNLPPKKKKPISKKKMKRERLKQGVAPPGE 70
                       789*****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190133.0E-6170No hitNo description
PfamPF046897.0E-40670IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MAVNEVEAKG LNPGLIVLLV IGGLLLTFLV GNFILYTYAQ KNLPPKKKKP ISKKKMKRER  60
LKQGVAPPGE
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX795431e-115X79543.1 S.oleracea s1fa mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.14e-24DNA-binding protein S1FA1
SwissprotP425524e-44S1FA_SPIOL; DNA-binding protein S1FA
TrEMBLA0A0K9QHJ64e-42A0A0K9QHJ6_SPIOL; Uncharacterized protein
STRINGPOPTR_0016s08890.15e-19(Populus trichocarpa)
Publications ? help Back to Top
  1. Zhou DX,Bisanz-Seyer C,Mache R
    Molecular cloning of a small DNA binding protein with specificity for a tissue-specific negative element within the rps1 promoter.
    Nucleic Acids Res., 1995. 23(7): p. 1165-9
    [PMID:7739894]